PR domain containing 8
Chromosome 5: 98,167,198-98,187,454 forward strand.
This transcript has 5 exons and is annotated with 28 domains and features.
This transcript is a product of gene OTTMUSG00000053329 Show transcript tableHide transcript table
PR domain containing 8
Chromosome 5: 98,167,198-98,187,454 forward strand.
This transcript has 5 exons and is annotated with 28 domains and features.
This transcript is a product of gene OTTMUSG00000053329 Show transcript tableHide transcript table
.
Exons: 5 Transcript length: 3,316 bps Translation length: 688 residues
This transcript is a member of the Mouse CCDS set: CCDS39178
Known protein coding [Definition]
This transcript was annotated by Havana
Version 1, last modified on 19/11/2015 (Created on 19/11/2015)
RP23-463H17.1-002
RNA-Seq supported partial [Definitions]
71aa upstream ORF MAVPCALFAVPQTPPRSSRQPLPPSQLLQKSPVRIGKPRLGYRPDRGFRARDFRGRLARIERPHIPQNPQD*
alternative 5' UTR
upstream uORF
This transcript maps to 98,167,198-98,187,454 in GRCm38 (Ensembl) coordinates.
Jump to this stable ID in Ensembl
Ensembl transcript having exact match with Havana: |
---|
.